DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and fgd6

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001093450.1 Gene:fgd6 / 556459 ZFINID:ZDB-GENE-041210-200 Length:1315 Species:Danio rerio


Alignment Length:276 Identity:88/276 - (31%)
Similarity:125/276 - (45%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGN-IVIGKKKYNKQHIMPLEEVSLESIAD 92
            :...|||.:.||.|.|:.||..:.|.||||||||:|.. :..|:.|.|....:...:||..|   
Zfish   981 IVQPGRVFLKEGTLMKLSRKVMQPRMFFLFNDILLYTTPVQSGQYKVNSMLSLAGMKVSKPS--- 1042

  Fly    93 NQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRK-----SGKK-----------P 141
            .:.|:|...|.:..:||::.|.::||:.||:..|...::|..||     |.:.           |
Zfish  1043 QEAYQNELNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLP 1107

  Fly   142 VENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDA 206
            :.:.|.:|:||...::||.| ..:||...||||||.||.|||..||:.||.|.....:..||||.
Zfish  1108 LGSKAPIWIPDLRTTMCMIC-TCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDH 1171

  Fly   207 CYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGESHDEPRFYGDNS 271
            ||.:|:|                          .||.||      .|.||.|.............
Zfish  1172 CYIKLQH--------------------------KGDQSN------VTFSPSGRGSTFAFSRKQKK 1204

  Fly   272 VLSAVEDSSTITSPSS 287
            :.||:::.|..|..||
Zfish  1205 IPSALKEVSANTENSS 1220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 36/100 (36%)
PH 39..131 CDD:278594 33/92 (36%)
FYVE_PKHF 148..208 CDD:277257 28/59 (47%)
fgd6NP_001093450.1 DUF4775 <93..327 CDD:292620
RhoGEF 773..957 CDD:279015
PH-like 975..1097 CDD:302622 40/118 (34%)
PH 990..1080 CDD:278594 33/92 (36%)
FYVE_FGD6 1113..1173 CDD:277282 28/60 (47%)
PH 1221..1313 CDD:278594 88/276 (32%)
PH2_FGD5_FGD6 1221..1309 CDD:270057 88/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.