DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and plekhf1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001016010.1 Gene:plekhf1 / 548764 XenbaseID:XB-GENE-996039 Length:269 Species:Xenopus tropicalis


Alignment Length:289 Identity:135/289 - (46%)
Similarity:178/289 - (61%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYG 65
            |||:|..:|.|.:|||.||||||:||.||:..||||||||:|||.|||:||.|.||||:||||||
 Frog     1 MVDQLAFTEINAQRIAVVENCFGTSGQPLSTPGRVLVGEGILTKECRKKPKPRTFFLFSDILVYG 65

  Fly    66 NIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV 130
            ||||.|.:||.|.|:|||:|::|.:.|:...||.|.|:|:.|||||.||:.:|::||:.||.:|:
 Frog    66 NIVINKVRYNTQRIIPLEDVTVEILPDSIDMRNRWMIKTSKKSFVVSAASYSERKEWICHIEECI 130

  Fly   131 EDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQ 195
            ..||:|:|::|.:.|||.|:||....:||.|.:|.||.:.||||||.||.|||..||..|||:|.
 Frog   131 HQLLQKTGRQPSKEHAAPWIPDKATDICMRCTQTNFTLVNRRHHCRKCGFVVCHECSKYKFLIPT 195

  Fly   196 QSTKALRVCDACYERL------------KH-------VPSSLGSGEDSAAATGAASGNKLNTTAG 241
            ..:|.:|||..||::|            :|       ||....|.|||                 
 Frog   196 IKSKPVRVCSLCYKKLVSEKVAIEEEVKRHERQFHDAVPEYDPSSEDS----------------- 243

  Fly   242 DSSNDEDSDEETASPGGESHDEPRFYGDN 270
                |||::.:.|.|..|.     ||..:
 Frog   244 ----DEDAERQGAWPLNED-----FYSSS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 74/121 (61%)
PH 39..131 CDD:278594 54/91 (59%)
FYVE_PKHF 148..208 CDD:277257 30/59 (51%)
plekhf1NP_001016010.1 PH_Phafin2-like 7..129 CDD:269927 74/121 (61%)
PH 39..131 CDD:278594 54/91 (59%)
PHD_SF 148..211 CDD:304600 32/62 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52283
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46280
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.