DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Sara

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_524729.2 Gene:Sara / 44263 FlyBaseID:FBgn0026369 Length:1343 Species:Drosophila melanogaster


Alignment Length:262 Identity:64/262 - (24%)
Similarity:90/262 - (34%) Gaps:96/262 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALR 202
            ||.|     .:||||..|..||.|:: :||.|:||||||.||.|:|:.|.:::|.|...:....|
  Fly   522 GKVP-----PIWVPDNMAGQCMQCQQ-KFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESR 580

  Fly   203 VCDACYERLKHVPSSLGSGEDSAAATGAA-------SGNK------------------------- 235
            ||..||..|.   ....:|.:|.:|.|:|       |.|.                         
  Fly   581 VCVQCYMILS---ERQANGLNSESAPGSALPPTPIRSPNPNNPMEYCSTIPPHRQVANSPGAPPP 642

  Fly   236 --------LNTTAGDSSNDEDSD-------------EETASPGGE-------------------- 259
                    |..|.|.|||...||             .:..:||.|                    
  Fly   643 SVIVPVGVLKKTDGSSSNSSSSDGQKGQRKRKSVMFSDGIAPGSELASTMEQQWGESKHSRRGLS 707

  Fly   260 --------------SHDEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVTPSVQSSPAAVA 310
                          :.:.||....:|.|..|......:.|.||...:|.|.:.:....||.:...
  Fly   708 RSGSGAGQKPPTPATEEPPRSIDTSSTLGLVAQLFRGSIPPSAAAATLSATETSAGRSSSQSQAQ 772

  Fly   311 TT 312
            |:
  Fly   773 TS 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 27/59 (46%)
SaraNP_524729.2 FYVE_endofin 522..589 CDD:277268 32/72 (44%)
SARA 614..650 CDD:288292 2/35 (6%)
DUF3480 959..1321 CDD:288806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1089
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.