Sequence 1: | NP_001284784.1 | Gene: | rush / 31105 | FlyBaseID: | FBgn0025381 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524729.2 | Gene: | Sara / 44263 | FlyBaseID: | FBgn0026369 | Length: | 1343 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 64/262 - (24%) |
---|---|---|---|
Similarity: | 90/262 - (34%) | Gaps: | 96/262 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 GKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALR 202
Fly 203 VCDACYERLKHVPSSLGSGEDSAAATGAA-------SGNK------------------------- 235
Fly 236 --------LNTTAGDSSNDEDSD-------------EETASPGGE-------------------- 259
Fly 260 --------------SHDEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVTPSVQSSPAAVA 310
Fly 311 TT 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rush | NP_001284784.1 | PH_Phafin2-like | 7..129 | CDD:269927 | |
PH | 39..131 | CDD:278594 | |||
FYVE_PKHF | 148..208 | CDD:277257 | 27/59 (46%) | ||
Sara | NP_524729.2 | FYVE_endofin | 522..589 | CDD:277268 | 32/72 (44%) |
SARA | 614..650 | CDD:288292 | 2/35 (6%) | ||
DUF3480 | 959..1321 | CDD:288806 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm1089 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2928 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |