DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Rufy4

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006496192.1 Gene:Rufy4 / 435626 MGIID:3588214 Length:595 Species:Mus musculus


Alignment Length:53 Identity:18/53 - (33%)
Similarity:24/53 - (45%) Gaps:8/53 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 CMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDACYER 210
            |:.|.|. |..:.||:.||.||.:||..||.       ...|..|.|..|.::
Mouse   545 CIGCNKV-FRRLSRRYPCRLCGGLVCHACSV-------DYKKRERCCPTCAQQ 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 17/49 (35%)
Rufy4XP_006496192.1 RUN 41..163 CDD:383089
OmpH 448..>524 CDD:377167
FYVE_RUFY4 544..586 CDD:277284 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.