DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and CG31064

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster


Alignment Length:222 Identity:52/222 - (23%)
Similarity:85/222 - (38%) Gaps:60/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRLVNSEANTR-----RIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDIL 62
            :|...:||.:|     ||:..|.       .|.::.::...:|.|.::..::.::          
  Fly   697 ERAARAEAESRIEREWRISLQEK-------ELKLKEKIANLQGCLKELSEEKERN---------- 744

  Fly    63 VYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGW-YIRTTTKSFVVFAATSTEKQEWMAHI 126
                   ||.|                 ||....|..| ..:||.:...:..:.|..|...|...
  Fly   745 -------GKLK-----------------ADLDKVRTQWSEAQTTLEELGIQLSVSKLKVSEMQDQ 785

  Fly   127 NKCVEDLLRKSGKK-----PVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGC 186
            .:....||..|.:.     .......:|.||:.|:.|..|:: :|...:|:||||:||.:.|..|
  Fly   786 ERRQRQLLSGSAQSLQAMPEAVGSPGIWAPDSIATHCTACER-EFNLTRRKHHCRSCGEIFCKAC 849

  Fly   187 SAKKFLLP-----QQSTKALRVCDACY 208
            |  :..||     .|..|.:||||.||
  Fly   850 S--EHTLPLLNAQGQPGKPVRVCDNCY 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 21/127 (17%)
PH 39..131 CDD:278594 14/92 (15%)
FYVE_PKHF 148..208 CDD:277257 25/64 (39%)
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 25/63 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.