DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and CG5270

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_731570.2 Gene:CG5270 / 41370 FlyBaseID:FBgn0037897 Length:2243 Species:Drosophila melanogaster


Alignment Length:198 Identity:50/198 - (25%)
Similarity:82/198 - (41%) Gaps:48/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRKSGKKPVENHAA-------------------- 147
            :||:::|::....|.::..::.  ..|::.|||....|.::.|.|                    
  Fly  1361 QTTSEAFILLNFNSYQQDHFVG--QDCLDLLLRIYASKALDYHVANVRAASEPSSLGTDVHNSLD 1423

  Fly   148 ----------------VWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQ- 195
                            .|..|.:||.||.|::..||.:.||||||.||.|||..||..:..:|: 
  Fly  1424 SLCGAFVMPKQAPNRQQWTRDEEASHCMCCRRAAFTMLMRRHHCRRCGRVVCYACSTHRIRIPEL 1488

  Fly   196 QSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGES 260
            .....:|:|:.|  .....|:. ..|:.:::...|.||.     ...||...||.:...| |..:
  Fly  1489 YDELEVRICNDC--AACSTPAK-DQGDGTSSERSAISGQ-----VSKSSGRSDSCKWQLS-GIIT 1544

  Fly   261 HDE 263
            ||:
  Fly  1545 HDK 1547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 4/25 (16%)
PH 39..131 CDD:278594 5/27 (19%)
FYVE_PKHF 148..208 CDD:277257 25/60 (42%)
CG5270NP_731570.2 PHD_SF 1441..1500 CDD:304600 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.