DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and plekhf1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_956634.1 Gene:plekhf1 / 393311 ZFINID:ZDB-GENE-040426-1289 Length:293 Species:Danio rerio


Alignment Length:274 Identity:108/274 - (39%)
Similarity:145/274 - (52%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYG 65
            |.:.|..:..|..||.:||:.||.:|..|...||.|||||.|.|:||:.|:.|.|:|||||||||
Zfish     1 MAEHLAFTIQNRERIQAVESSFGRTGKMLQKPGRFLVGEGCLQKLCRRGPQPRVFYLFNDILVYG 65

  Fly    66 NIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV 130
            :|::..:..|||:|:|||||..|.:.|.....|.|.|||..|||.|.|.:..||..||.||.:..
Zfish    66 SIMLHGRWNNKQNIIPLEEVQQEDLEDGMAMANQWLIRTPRKSFYVSAESPEEKIAWMGHIEQYR 130

  Fly   131 EDLLRKSG---KKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFL 192
            ...::..|   ||..::.|..|:||..:::||.|.| :||...||||||.||.:||..||..:.:
Zfish   131 TLHVKNKGLPAKKSGDDFATPWIPDVASAICMRCSK-RFTVANRRHHCRRCGYIVCQACSKGRAV 194

  Fly   193 LPQQSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGN--KLNT-----TAGDSSNDEDSD 250
            ||..|.:.:|||..|       .:.:..|.........|.||  |.|:     |..:..|..|.:
Zfish   195 LPHISNRPVRVCRNC-------KNDMTDGMRQVQGKMRAKGNHWKKNSVEDTPTMPEFENSSDEE 252

  Fly   251 EETASPGGESHDEP 264
            .|.|.   |.|..|
Zfish   253 NENAD---ECHQVP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 60/121 (50%)
PH 39..131 CDD:278594 46/91 (51%)
FYVE_PKHF 148..208 CDD:277257 27/59 (46%)
plekhf1NP_956634.1 PH_Phafin2-like 7..129 CDD:269927 60/121 (50%)
PH 39..128 CDD:278594 46/88 (52%)
PHD_SF 151..209 CDD:304600 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46280
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.