DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and zfyve26

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_021336194.1 Gene:zfyve26 / 324565 ZFINID:ZDB-GENE-030131-3286 Length:2555 Species:Danio rerio


Alignment Length:194 Identity:59/194 - (30%)
Similarity:76/194 - (39%) Gaps:48/194 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RKSGKK---------PVEN--HAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSA 188
            |.||||         |.|.  ....|:||....:||.|::.:||...||||||.||.:||..||:
Zfish  1797 RPSGKKIRPLATPFTPPEKTPDRKDWIPDHKQHICMVCQRERFTMFNRRHHCRRCGRLVCHSCSS 1861

  Fly   189 KKFLLPQQSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEET 253
            ||..: ....:.:||||.||                         |..:|   ||..:.:..|..
Zfish  1862 KKMAV-AGFDEPVRVCDQCY-------------------------NFFHT---DSDEELEQGEVA 1897

  Fly   254 ASPGGESHDEPRFYGDNSVLSAVEDS--STITSPSSATTGSLEAPQVTPSVQSSPAAVATTGSH 315
            .||  .|.||..    |.|||..|.|  ....||:.|....|::........|:...||....|
Zfish  1898 GSP--SSIDEVL----NGVLSLPEVSRKQYRLSPNPAENQQLKSEFYYEQAPSASLCVAILTLH 1955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 26/59 (44%)
zfyve26XP_021336194.1 FYVE_ZFY26 1822..1881 CDD:277263 28/84 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.