DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Fyco1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001100340.1 Gene:Fyco1 / 301085 RGDID:1309069 Length:1451 Species:Rattus norvegicus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:94/244 - (38%) Gaps:58/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLRK 136
            |||       |||..:|.:.|....   |.           .:.:.|.|:.::...||:.|:   
  Rat  1107 KKY-------LEERLIELLRDKDAL---WQ-----------KSDALEFQQKLSAEEKCLGDM--- 1147

  Fly   137 SGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKAL 201
                             :|:.|..||: :|::|.||||||.||.:.|..| ...:::.:.|.|..
  Rat  1148 -----------------EANHCHDCKR-EFSWIVRRHHCRLCGRIFCYYC-CNNYVVTKPSGKKE 1193

  Fly   202 RVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGESHDEPRF 266
            |.|.||:::.         ||.|.:...:.||......:...|..|.:.:...|.|......|  
  Rat  1194 RCCRACFQKF---------GESSGSPDSSGSGTSQGEPSPMVSPAEAAPQSIGSQGINPVCRP-- 1247

  Fly   267 YGDNSVLSAVEDSSTITSPSSATTGSL-EAPQVTPSVQSSPAAVATTGS 314
             .|::|...:.|........|.:  || |.|..|.|:..:.|...||.:
  Rat  1248 -PDDAVFDIITDEELCQIQESGS--SLPETPTETDSMDPNMAEQDTTSN 1293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 11/56 (20%)
PH 39..131 CDD:278594 13/58 (22%)
FYVE_PKHF 148..208 CDD:277257 21/59 (36%)
Fyco1NP_001100340.1 RUN 59..164 CDD:413440
MukB <237..>519 CDD:225638
SMC_prok_B 392..>1117 CDD:274008 6/16 (38%)
FYVE_FYCO1 1144..1200 CDD:277265 22/77 (29%)
GOLD_2 <1392..1437 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.