DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and pep7

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_594255.1 Gene:pep7 / 2542423 PomBaseID:SPAC17G6.08 Length:536 Species:Schizosaccharomyces pombe


Alignment Length:166 Identity:39/166 - (23%)
Similarity:65/166 - (39%) Gaps:43/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HIMPLEEVSLESIADNQTYRNGWY--------------------IRTTTKSFVVFAATSTEKQE- 121
            |.|...::|:.:..|::   ||::                    ||:..::|..|.....:|:. 
pombe   169 HSMYQIKLSIHATYDSE---NGFWCRVCRECYEGRPGYNDSNGLIRSRFQTFETFRKPLADKRRI 230

  Fly   122 ---------------WMAHINKCVEDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQR 171
                           |.:. |..:.|.|..:..|.:|.....|..|:...:|..|..: ||..:|
pombe   231 EFLRLSKRMKKLEELWTSE-NVSMLDALLLNKAKRLEQSIVHWQDDSVVQICPECNNS-FTLTRR 293

  Fly   172 RHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDAC 207
            |.|||.||.|:|..| ..:..|||. .:.|.:|.:|
pombe   294 RRHCRLCGRVICRFC-VLEISLPQH-PQPLLICMSC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 13/86 (15%)
PH 39..131 CDD:278594 13/88 (15%)
FYVE_PKHF 148..208 CDD:277257 22/60 (37%)
pep7NP_594255.1 FYVE1_Vac1p_like 128..205 CDD:277300 6/38 (16%)
FYVE 271..333 CDD:214499 22/60 (37%)
Rbsn 483..522 CDD:288341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.