DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and FGD2

DIOPT Version :10

Sequence 1:NP_569923.2 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_775829.2 Gene:FGD2 / 221472 HGNCID:3664 Length:655 Species:Homo sapiens


Alignment Length:196 Identity:47/196 - (23%)
Similarity:86/196 - (43%) Gaps:24/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LVGEGVLTKMCRKR--PKSRQFFLFNDILVY--GNIVIGKKKYNKQHIMPLEEVSLESIADNQTY 96
            |:.||.:.|:..:|  |..|..||||::|:|  ..::....::..:..:.:..:.:..:.|.: :
Human   320 LLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGAQFQVRTRIDVAGMKVRELMDAE-F 383

  Fly    97 RNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCVEDLLR-----KSGKKPVEN------------ 144
            .:.:.:....::..:.|.:..|...||......::.:.:     |:..:..|.            
Human   384 PHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEEL 448

  Fly   145 --HAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVCDAC 207
              .|..||.|...::||.|::......:||||||.||.||||.||..:..|.....:..|||..|
Human   449 GLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELKYDDNRPNRVCLHC 513

  Fly   208 Y 208
            |
Human   514 Y 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_569923.2 PH_Phafin2-like 7..129 CDD:269927 18/96 (19%)
FYVE_PKHF 148..208 CDD:277257 24/59 (41%)
FGD2NP_775829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..64
RhoGEF 104..288 CDD:238091
PH1_FGD2 320..427 CDD:275421 18/107 (17%)
FYVE_FGD1_2_4 453..517 CDD:277280 26/62 (42%)
PH2_FGD1-4 538..640 CDD:270056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.