DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Zfyve16

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_775568.1 Gene:Zfyve16 / 218441 MGIID:2145181 Length:1528 Species:Mus musculus


Alignment Length:255 Identity:71/255 - (27%)
Similarity:97/255 - (38%) Gaps:86/255 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KKYNKQHIMPLEE-------------VSLESIADNQTYRNGWYIRTTT-----KSFVVFAATSTE 118
            |:.||..::.:.|             .|.:.|.|:|...|..||...:     .|||.....|..
Mouse   651 KELNKPDVVDVPESEPCTANATAVSTCSADHIPDSQVSFNSNYIDIESNFEDGSSFVTANKDSLP 715

  Fly   119 KQEWMAHINKCVEDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVC 183
            :       ||..|.|: ...|:|      .||||::|..||:| :.:|||.:||||||.||.|.|
Mouse   716 E-------NKRKESLV-LGQKQP------TWVPDSEAPNCMNC-QVKFTFTKRRHHCRACGKVFC 765

  Fly   184 AGCSAKKFLLPQQSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDED 248
            ..|..:|..| |...|..|||..|||.:                                 |...
Mouse   766 GVCCNRKCKL-QYLEKEARVCVICYETI---------------------------------NKAQ 796

  Fly   249 SDEETASPGG----ESH------DEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQV 298
            :.|...||||    .:|      |:|        |...:.||| .||::....:|:.|.|
Mouse   797 AFERMMSPGGSCLKSNHSNECATDQP--------LQETQTSST-PSPTTLPISALKQPNV 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 16/74 (22%)
PH 39..131 CDD:278594 17/76 (22%)
FYVE_PKHF 148..208 CDD:277257 29/59 (49%)
Zfyve16NP_775568.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 629..664 3/12 (25%)
FYVE_endofin 726..792 CDD:277268 34/73 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..849 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 928..949
DUF3480 1155..1503 CDD:288806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.