DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and aka-1

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_495565.2 Gene:aka-1 / 174216 WormBaseID:WBGene00000101 Length:1284 Species:Caenorhabditis elegans


Alignment Length:179 Identity:54/179 - (30%)
Similarity:83/179 - (46%) Gaps:30/179 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAG-CSAKKFL--LPQQSTK--ALRVCDACY 208
            |:||::...||.| .|:||.|.||||||.||.|:|.. |:.|.||  |.::..|  |:|||..|.
 Worm   538 WIPDSECPNCMLC-NTRFTIITRRHHCRACGRVLCGSCCNEKAFLEYLQEEGKKLQAVRVCKPCS 601

  Fly   209 ERLKHVPSSLGSGEDSAAATGAASGNKLNTTAGDSSNDEDSDEETASPGGESHDEPRFYGDNSVL 273
            ..|..:.:.  ..::.......||.|.|   :||.:........|:.|.|....:|..:.:.   
 Worm   602 AMLARIETH--EQDEQRRRESIASENGL---SGDETISSIPAASTSIPRGVLKTKPTVHVNE--- 658

  Fly   274 SAVEDSSTITSPSSATTGSLEAPQVTPSVQSS--------PAAVATTGS 314
               ||.::.:|.:.:|:|:     |:.|.:.|        |.|.|..|:
 Worm   659 ---EDGASTSSQAHSTSGN-----VSDSSRRSVMFRDGVRPGAPADEGN 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927
PH 39..131 CDD:278594
FYVE_PKHF 148..208 CDD:277257 30/63 (48%)
aka-1NP_495565.2 PTZ00341 <334..>477 CDD:173534
FYVE_endofin 532..604 CDD:277268 31/66 (47%)
DUF3480 905..1257 CDD:371829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.