DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and FGD5

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011531724.1 Gene:FGD5 / 152273 HGNCID:19117 Length:1464 Species:Homo sapiens


Alignment Length:319 Identity:73/319 - (22%)
Similarity:124/319 - (38%) Gaps:79/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKK--K 73
            |.:::..:|:.....| .|...||..:.||.|.|:..|..:.|..||.||:|:|   ...:|  |
Human  1090 NLQKLVHIEHSVRGQG-DLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLLY---TYPQKDGK 1150

  Fly    74 YNKQHIMPLEEVSL-ESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV-EDLLRK 136
            |..::.:.:..:.: ..:.:...|  ...|.|:....::.|::..|:.||...:::.: ||...:
Human  1151 YRLKNTLAVANMKVSRPVMEKVPY--ALKIETSESCLMLSASSCAERDEWYGCLSRALPEDYKAQ 1213

  Fly   137 S------------------GKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVC 183
            :                  |::|     ...||.|...:||:| ...|:...|||||..||.:||
Human  1214 ALAAFHHSVEIRERLGVSLGERP-----PTLVPVTHVMMCMNC-GCDFSLTLRRHHCHACGKIVC 1272

  Fly   184 AGCSAKKFLLPQQSTKALRVCDACYERLKH----VPSSLGSGEDSAAATGAASGNKLNTTAGDSS 244
            ..||..|:.|.....:..:|||.|:..||.    ||..:...|...:.:...|            
Human  1273 RNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRVTERPVSMSFPLS------------ 1325

  Fly   245 NDEDSDEETASPGGESHDEPRFYGD--NSVLSAVEDS---------STITSPSSATTGS 292
                              .|||.|.  :||..::..|         |.:|..:::..||
Human  1326 ------------------SPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGS 1366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 28/120 (23%)
PH 39..131 CDD:278594 22/95 (23%)
FYVE_PKHF 148..208 CDD:277257 23/59 (39%)
FGD5XP_011531724.1 RhoGEF 896..1083 CDD:279015
PH1_FGD5 1101..1223 CDD:275435 28/127 (22%)
PH 1116..1207 CDD:278594 22/95 (23%)
FYVE_FGD5 1237..1303 CDD:277281 26/66 (39%)
PH 1368..1462 CDD:278594
PH2_FGD5_FGD6 1368..1458 CDD:270057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.