DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and Fgd6

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_036011484.1 Gene:Fgd6 / 13998 MGIID:1261419 Length:1401 Species:Mus musculus


Alignment Length:256 Identity:75/256 - (29%)
Similarity:122/256 - (47%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAMQGR--VLVGEGVLTKMCRKRPKSRQFFLFNDILVYGNIVIGKKKYNKQHIMPLEEVSLESIA 91
            :...||  |.:.||.|.|:.||..:.|.||||||.|:| ...:....|...:::.|..:.:.. .
Mouse  1053 IVQPGRNDVFLKEGTLMKLSRKVMQPRMFFLFNDALLY-TTPMQSGMYKLNNMLSLAGMKVRK-P 1115

  Fly    92 DNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAHINKCV-----------------EDLLRKSGK 139
            ..:.|:|...|.:..:||::.|:::.|:.:|:..|:..:                 ||..||...
Mouse  1116 TQEAYQNELKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRSLDEDSERKEEV 1180

  Fly   140 KPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGAVVCAGCSAKKFLLPQQSTKALRVC 204
            .|:...|.:|:|||.|::||.| .::||...||||||.||.:||..||:.|:.|.....:..|||
Mouse  1181 SPLGAKAPIWIPDTRATMCMIC-TSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVC 1244

  Fly   205 DACYERLKHVPSSL-------GSGEDSAAATGAA-----SGNKLNTTAGD----SSNDEDS 249
            :.|::.|:.:...|       |:.:..::|..:.     ||.|.......    |:|.|||
Mouse  1245 EHCFQELQKLDHQLSPRVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDS 1305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 29/101 (29%)
PH 39..131 CDD:278594 26/108 (24%)
FYVE_PKHF 148..208 CDD:277257 27/59 (46%)
Fgd6XP_036011484.1 RhoGEF 845..1028 CDD:395496
PH-like 1047..1171 CDD:418428 29/119 (24%)
FYVE_FGD6 1188..1248 CDD:277282 27/60 (45%)
PH2_FGD5_FGD6 1307..1395 CDD:270057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.