DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rush and fgd5b

DIOPT Version :9

Sequence 1:NP_001284784.1 Gene:rush / 31105 FlyBaseID:FBgn0025381 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001352385.1 Gene:fgd5b / 101884144 ZFINID:ZDB-GENE-130925-3 Length:1299 Species:Danio rerio


Alignment Length:230 Identity:70/230 - (30%)
Similarity:105/230 - (45%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRLVNSEANTRRIASVE-NCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFNDILVY-- 64
            |.|.|. |:..|:..:| :..|.:  .|...|||.|.||.|.|:.||..:.|..||.|||::|  
Zfish   944 DSLKNG-ADLMRLVHIEHSVLGLT--DLIQPGRVFVKEGTLMKVSRKCKQPRHLFLMNDIMLYTY 1005

  Fly    65 ----GNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQEWMAH 125
                |       ||...:.:||..:.: |....::.::...|.....|..:.|::..|:..|...
Zfish  1006 PQQDG-------KYRLINRLPLAGMKV-SKPPMESAQSAIKIEVKDISITLSASSCIERDGWFVT 1062

  Fly   126 INKCVEDLLRKSGKKPVENHAAVWVPD-------------TDASVCMHCKKTQFTFIQRRHHCRN 177
            :|:.:.||...|| .||::...|..|:             :..:|||:| .:.|:...|||||..
Zfish  1063 MNRTLVDLGSASG-DPVDSFELVESPEKCLGENAPPLLSVSQVTVCMNC-PSHFSLTNRRHHCHA 1125

  Fly   178 CGAVVCAGCSAKKFLLPQQSTKALRVCDACYERLK 212
            ||.|||..|...||.|.....:..:|||.||..|:
Zfish  1126 CGKVVCRDCCRNKFPLKYMKNRRAKVCDHCYTELR 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rushNP_001284784.1 PH_Phafin2-like 7..129 CDD:269927 35/128 (27%)
PH 39..131 CDD:278594 25/97 (26%)
FYVE_PKHF 148..208 CDD:277257 24/72 (33%)
fgd5bNP_001352385.1 RhoGEF 791..939 CDD:238091
PH-like 962..1069 CDD:327399 31/116 (27%)
FYVE_like_SF 1096..1161 CDD:333710 25/66 (38%)
PH2_FGD5_FGD6 1207..1293 CDD:270057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.