DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-38 and CG5781

DIOPT Version :9

Sequence 1:NP_001334676.1 Gene:mei-38 / 31104 FlyBaseID:FBgn0260986 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_609583.1 Gene:CG5781 / 34678 FlyBaseID:FBgn0032448 Length:266 Species:Drosophila melanogaster


Alignment Length:258 Identity:66/258 - (25%)
Similarity:108/258 - (41%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 NWGKDGDDDEKHMTEADQHLVHQERP---PG-------VGAKLRLEWSPPRHREHEGAGASATSA 193
            ||......:|.|           .||   ||       :.|.|:........|:...||...:.|
  Fly     8 NWSVKDLSNESH-----------ARPKLIPGFDQLDKRLQAALQERDVQKHQRKRTQAGGGQSQA 61

  Fly   194 APK-----------AYQFKDVYESKRQQAMRKRSEEESKARQFHSRPMPNFKAMHKRMNE----L 243
            .||           ..:|:.||..||:: :::.:..:|.|.||.|||:|:|:..|:|:..    |
  Fly    62 KPKKLKTTRKQTPRVCKFQKVYTEKRKK-LKREANMQSNAFQFRSRPVPDFERSHRRLERRKLYL 125

  Fly   244 AVIHKITVPRTPETLKHSQSNVERRRDDDPADQ------ARLHPAG------------------T 284
            ..:..:|.||.|.||..|...:.:|.......:      .|::|..                  |
  Fly   126 NSLQTVTKPRCPATLATSMVALNKRLKKQRQSRKTSDFVPRINPGSSMDYLNRQPFTPLVKSSFT 190

  Fly   285 RSRPFHLRSEQRVRDRREFDAAVQVSLEQKKKEQDEQRKRCEQEEIKELRKMTAFKARPNPFK 347
            ..:||||.:.:|...|:.:|...::.::::.::|.......|:.|..:|||||.|||.|||:|
  Fly   191 HPKPFHLHTSERALRRQVYDERKRIRMDRRLEQQTIDWFARERSEYFKLRKMTNFKATPNPWK 253



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016770
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.