DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and SEC4

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:74/182 - (40%)
Similarity:120/182 - (65%) Gaps:12/182 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGSGEQF------LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHL 72
            :|:|:.:      |::|||||||:|||.::.:.:|:..||:|:||||:.|.:..|.:    ::.|
Yeast    11 SGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGK----KVKL 71

  Fly    73 QIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKC 137
            |:||||||||||::|||:||.|||.:|::|:|.|::|.....|...:..|| :::..::|.|||.
Yeast    72 QLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHA-NDEAQLLLVGNKS 135

  Fly   138 DLLQLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIEN 189
            | ::.|||:.||..||.:...:|:||:||....||.|....|...:.|:|::
Yeast   136 D-METRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 71/173 (41%)
RAB 20..186 CDD:197555 70/171 (41%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 70/170 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.