DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RAB1C

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_193486.1 Gene:RAB1C / 827468 AraportID:AT4G17530 Length:202 Species:Arabidopsis thaliana


Alignment Length:169 Identity:67/169 - (39%)
Similarity:108/169 - (63%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.|::|||||||:|||.::.|..:...:|||:|:||:.:.:..:.:    .|.||||||||||||
plant    10 KLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGK----TIKLQIWDTAGQERF 70

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148
            |::|:::||.|.|.::.:|:|..:||.....||:::..:| ||:.:.:|.||||||...:|||.:
plant    71 RTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYA-SENVNKLLVGNKCDLTSQKVVSTE 134

  Fly   149 QVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI 187
            ...|......:|::||||....||:||...:...:..|:
plant   135 TAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 66/167 (40%)
RAB 20..186 CDD:197555 66/165 (40%)
RAB1CNP_193486.1 Rab1_Ypt1 7..172 CDD:206661 66/166 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.