DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RAB8

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001078278.1 Gene:RAB8 / 824529 AraportID:AT3G53610 Length:216 Species:Arabidopsis thaliana


Alignment Length:178 Identity:77/178 - (43%)
Similarity:114/178 - (64%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.|::|||||||:|||.:::||.|.|.||:|:||||:.:.:..:.:    ||.||||||||||||
plant    17 KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGK----RIKLQIWDTAGQERF 77

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQ-LRVVSR 147
            |::|||:||.|||.||::|:|.|.||....||:..:..|| |:..:.:|.|||.|:.: .|.|.:
plant    78 RTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHA-SDSVNKILVGNKADMDESKRAVPK 141

  Fly   148 DQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNRE 195
            .:..||...|.:.:.||||.|..||:|....:...:.:|:.:.....|
plant   142 SKGQALADEYGMKFFETSAKTNLNVEEVFFSIAKDIKQRLADTDARAE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 75/168 (45%)
RAB 20..186 CDD:197555 75/166 (45%)
RAB8NP_001078278.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 75/167 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.