DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab1a

DIOPT Version :10

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_112352.2 Gene:Rab1a / 81754 RGDID:619736 Length:205 Species:Rattus norvegicus


Alignment Length:169 Identity:63/169 - (37%)
Similarity:107/169 - (63%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.|::|||||||:|||.::.|..:...:|||:|:||:.:.:..:.:    .|.||||||||||||
  Rat    13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGK----TIKLQIWDTAGQERF 73

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148
            |::|:::||.|.|.::::|:|.::||.....||.::..:| ||:.:.:|.||||||...:||...
  Rat    74 RTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYA-SENVNKLLVGNKCDLTTKKVVDYT 137

  Fly   149 QVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI 187
            ..........:|::||||....||:::...:...:.:|:
  Rat   138 TAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop containing Nucleoside Triphosphate Hydrolases 19..187 CDD:476819 62/167 (37%)
Rab1aNP_112352.2 Rab1_Ypt1 10..175 CDD:206661 62/166 (37%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 34..48 4/13 (31%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 66..83 11/16 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.