DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RAB27B

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001362256.1 Gene:RAB27B / 5874 HGNCID:9767 Length:218 Species:Homo sapiens


Alignment Length:176 Identity:106/176 - (60%)
Similarity:136/176 - (77%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYN------SRGRRHRIHLQIWDT 77
            :.|.|||||||||..||:|||.:|:.:||:||||||||||::||      |.|:..::|||:|||
Human    11 KLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDT 75

  Fly    78 AGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQL 142
            |||||||||||||:||||||||:|||||::|||...||:|||:.:||.|:||:||.|||.||...
Human    76 AGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ 140

  Fly   143 RVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIE 188
            |.|:..|...|..:|.:||.||||.||.||::|||.|:..:|:|:|
Human   141 REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRME 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 104/173 (60%)
RAB 20..186 CDD:197555 104/171 (61%)
RAB27BNP_001362256.1 Rab27A 6..185 CDD:206700 104/173 (60%)
Effector region. /evidence=ECO:0000250 38..46 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 228 1.000 Domainoid score I2493
eggNOG 1 0.900 - - E1_KOG0081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3403
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190514at2759
OrthoFinder 1 1.000 - - FOG0004299
OrthoInspector 1 1.000 - - otm42024
orthoMCL 1 0.900 - - OOG6_105898
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3032
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.