DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and rab27b

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_685861.5 Gene:rab27b / 561717 ZFINID:ZDB-GENE-120215-85 Length:245 Species:Danio rerio


Alignment Length:176 Identity:103/176 - (58%)
Similarity:132/176 - (75%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSR------GRRHRIHLQIWDT 77
            :.|.|||||||||..||:|||.:|:.:||:||||||||||::|.:.      |:..::|||:|||
Zfish    39 KLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYTTNSPNGTTGKTFKVHLQLWDT 103

  Fly    78 AGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQL 142
            |||||||||||||:||||||||:|||||::|||...||:|||:.:||.|:||:||.|||.||...
Zfish   104 AGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLVGNKADLADQ 168

  Fly   143 RVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIE 188
            |.|...|...|..:|.:||.||||.||:.|.:||..|:..||:|:|
Zfish   169 REVQEKQAKELADKYGIPYFETSAATGSEVDKAVVTLLDLVMKRME 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 101/173 (58%)
RAB 20..186 CDD:197555 101/171 (59%)
rab27bXP_685861.5 Rab27A 34..213 CDD:206700 101/173 (58%)
RAB 38..212 CDD:197555 101/172 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 223 1.000 Domainoid score I2505
eggNOG 1 0.900 - - E1_KOG0081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3425
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190514at2759
OrthoFinder 1 1.000 - - FOG0004299
OrthoInspector 1 1.000 - - otm24584
orthoMCL 1 0.900 - - OOG6_105898
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3032
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.