DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and rab27a

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001007970.1 Gene:rab27a / 493339 XenbaseID:XB-GENE-490563 Length:221 Species:Xenopus tropicalis


Alignment Length:176 Identity:109/176 - (61%)
Similarity:137/176 - (77%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSR------GRRHRIHLQIWDT 77
            :||.|||||||||..||||||.:|:::||:||||||||||::|.|.      ||..|:|||:|||
 Frog    11 KFLALGDSGVGKTSFLYQYTDAKFNSKFITTVGIDFREKRVVYRSNGPDGISGRGQRVHLQLWDT 75

  Fly    78 AGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQL 142
            |||||||||||||:||||||||:||||:|:|||...||:|||:.|||.|:||:|||||||||.:.
 Frog    76 AGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWMSQLQVHAYCENPDIVLCGNKCDLDEQ 140

  Fly   143 RVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIE 188
            |.|..::......:|.:||.||||..|.||.:|||.|:..:|:|:|
 Frog   141 RAVKEEEAKEFAEKYGIPYFETSAAIGTNVNKAVETLLDLIMKRME 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 107/173 (62%)
RAB 20..186 CDD:197555 107/171 (63%)
rab27aNP_001007970.1 Rab27A 6..185 CDD:206700 107/173 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3069
Inparanoid 1 1.050 232 1.000 Inparanoid score I3347
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190514at2759
OrthoFinder 1 1.000 - - FOG0004299
OrthoInspector 1 1.000 - - otm49252
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3121
SonicParanoid 1 1.000 - - X3032
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.