DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RabX4

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster


Alignment Length:207 Identity:81/207 - (39%)
Similarity:123/207 - (59%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRS 85
            ||||||.|||||::::|.|.:::..:|||:||||::|  |.|..|  ..|.|||||||||||||:
  Fly    12 LVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQK--LINLDG--VPIKLQIWDTAGQERFRT 72

  Fly    86 LTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDV--VLCGNKCDL-LQLRVVSR 147
            ||||:||.|||.||::|:|:.:|:...:.||..::.:|   .|||  ||.||||:. ...|:|.:
  Fly    73 LTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENA---SPDVVKVLAGNKCECSATQRMVDK 134

  Fly   148 DQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNRE----------------- 195
            ::...:...:.:|:.|.|..:..|:::|...|..::.|:.|....|.:                 
  Fly   135 ERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGT 199

  Fly   196 FSL--LLTQSRC 205
            |||  |..::||
  Fly   200 FSLGSLSGENRC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 73/168 (43%)
RAB 20..186 CDD:197555 72/167 (43%)
RabX4NP_733043.1 RAB 9..170 CDD:197555 72/164 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.