DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab23

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:183 Identity:55/183 - (30%)
Similarity:92/183 - (50%) Gaps:19/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRS 85
            :::|:.||||:.::.:|..|.|...:..|:|:||.|:::..:...    :.:.:|||||||.|..
  Fly    41 VIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGED----VRIMLWDTAGQEEFDC 101

  Fly    86 LTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQV 150
            :|.|:||.|...:|:|..|...||....:|..::.... :|.|.|:: .||.||::..||:.|:|
  Fly   102 ITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENEC-NEIPTVIV-QNKIDLIEQAVVTADEV 164

  Fly   151 AALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLLTQS 203
            ..|.:......|.||.....||......|..:         |::    |:|||
  Fly   165 ETLAKLLNCRLIRTSVKEDINVASVFRYLATK---------CHQ----LMTQS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 50/165 (30%)
RAB 20..186 CDD:197555 50/164 (30%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 47/163 (29%)
Rab23_like 50..197 CDD:133306 46/161 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.