DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RabX5

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:187 Identity:60/187 - (32%)
Similarity:98/187 - (52%) Gaps:17/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 APPEPE--PLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGR 66
            ||.:|:  |.::       :.:||..||||.::.::...:|.:.:.:|:|:||.    |.|....
  Fly    56 APRKPKFRPCKV-------IFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFE----LENFSIL 109

  Fly    67 RHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETA-NWLSQLRTHAYSEDPDV 130
            .|...|::||||||||||.:..|:||:|...::.:|: |:|..||:| .||:....:..|:.|.|
  Fly   110 GHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDM-SKKDSLESAKKWLNSALNYNASKRPLV 173

  Fly   131 VLCGNKCDLL-QLRVVSRDQVAAL-CRRYRLPYIETSACTGANVKEAVELLVGRVME 185
            .|.|.|.||| :...|..:::|.| ....:..|...||.:|..|.|..:.:.....|
  Fly   174 FLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 56/170 (33%)
RAB 20..186 CDD:197555 56/169 (33%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 55/175 (31%)
RAB 66..225 CDD:197555 55/170 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.