DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab32

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:189 Identity:54/189 - (28%)
Similarity:97/189 - (51%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EPEPLQLAGSGE------QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRG 65
            |.||..:..:.:      :.||:|:.|.|||..:.:|....|...:.:|:|:||..|.|.:::  
  Fly   467 EMEPAIMTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDA-- 529

  Fly    66 RRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDV 130
             ...:.||:||.||||||.::|..:|::|:|..::||:|...:|...:.|...|.:.....|...
  Fly   530 -NTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSP 593

  Fly   131 VLC---GNKCDLLQLRVVSR-DQVAALCRRYRLP-YIETSACTGANVKEAVELLVGRVM 184
            :.|   .||||..:..:::: :::....|..... :.||||....|:.||...||.:::
  Fly   594 IPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 51/171 (30%)
RAB 20..186 CDD:197555 51/170 (30%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 51/172 (30%)
RAB 484..652 CDD:197555 51/170 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.