DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab30

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:220 Identity:69/220 - (31%)
Similarity:113/220 - (51%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.:::|::|||||||:.::|.|.|.....:|:|:||..|.:....    .:|.||||||||||||
  Fly     9 KIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEG----EKIKLQIWDTAGQERF 69

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148
            ||:|.::||.|...:|::|::.:.:|....:||.:::.:|.|:... :|.|||.|        ||
  Fly    70 RSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLK-ILVGNKTD--------RD 125

  Fly   149 ------QVA-ALCRRYRLPYIETSACTGANVK----EAVELLVGRVMER-----IENAACNRE-- 195
                  |:. ...:::.:.::||||....||:    |....|:|:...:     ...||..|:  
  Fly   126 DREIPTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSE 190

  Fly   196 --------FSLLLTQSRCLPNIAYG 212
                    ||....||.|...:|.|
  Fly   191 GSSIGLGSFSAKAAQSNCCGGLASG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 59/183 (32%)
RAB 20..186 CDD:197555 59/176 (34%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 57/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.