DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab21

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:218 Identity:70/218 - (32%)
Similarity:108/218 - (49%) Gaps:20/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRS 85
            ::||:..||||.|:.:|.:.||:.|.:||:...|..:::.... ||  |..|.||||||||||.:
  Fly    17 VLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLED-GR--RAQLNIWDTAGQERFHA 78

  Fly    86 LTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQV 150
            |...:||.:.|.||::|:|...||.:..:|:.:||....:|.. :::.|||.||.:.|.|:.|:.
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIA-LIIVGNKTDLEEQRAVTHDEA 142

  Fly   151 AALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLLTQSRCLPNIAYGQPE 215
            ....|.....|:||||.....|.|..|||...::|::..           .|....|........
  Fly   143 LQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQ-----------RQPDASPLRLQNPDT 196

  Fly   216 DLVRLHDRRE-----EPCSRRNC 233
            |.:...|..|     :|..:|:|
  Fly   197 DNLNNSDDSEAPDPGDPAGQRSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 62/165 (38%)
RAB 20..186 CDD:197555 61/164 (37%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 61/162 (38%)
Ras 15..177 CDD:278499 61/163 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.