DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and Rab10

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster


Alignment Length:179 Identity:77/179 - (43%)
Similarity:124/179 - (69%) Gaps:7/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.|::|||||||||:|::::|..|.:.||||:||||:.|.:  ..||:  :|.||||||||||||
  Fly    11 KLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTV--ELRGK--KIKLQIWDTAGQERF 71

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148
            .::||::||.|||.:|::|:|:||||.....||..:..|| :||.:.::.|||||:...|||:::
  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHA-NEDVEKMILGNKCDMTDKRVVNKE 135

  Fly   149 QVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERI--ENAACNRE 195
            :..|:.|.:.:.::||||.:..|::.|...|...::::.  ..:|.|:|
  Fly   136 RGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 74/167 (44%)
RAB 20..186 CDD:197555 74/165 (45%)
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 74/166 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.