DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and RabX2

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:169 Identity:68/169 - (40%)
Similarity:96/169 - (56%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRS 85
            ||||||||||:|||.:::|.||..:::.|:|||.:.:.:...||    .:.||:|||:|.:||.|
  Fly    11 LVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSR----VMMLQVWDTSGDKRFNS 71

  Fly    86 LTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPD---VVLCGNKCDLLQLRVVSR 147
            |..:.||.|.|.||::|:||.|||.....|:.::|...    ||   |:|.|||.|....|.||.
  Fly    72 LMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMC----PDKVTVLLVGNKSDDPNHRQVSM 132

  Fly   148 DQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMER 186
            :|......|..|.:.|.||.:|.||.:....|...:..|
  Fly   133 EQGFNYAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 68/169 (40%)
RAB 20..186 CDD:197555 67/167 (40%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 67/167 (40%)
Rab 8..165 CDD:206640 66/161 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.