DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab27 and ypt2

DIOPT Version :9

Sequence 1:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:82/194 - (42%)
Similarity:115/194 - (59%) Gaps:12/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83
            :.|::|||||||:|||.::::..|...||:|:||||:.:.:..:.:    ||.||||||||||||
pombe    11 KLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGK----RIKLQIWDTAGQERF 71

  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148
            |::|||:||.|||.||::|:|.:|||.....|.|.:..|| ||:...:|.|||||....|.||.:
pombe    72 RTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHA-SENVYKILIGNKCDCEDQRQVSFE 135

  Fly   149 QVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMER-------IENAACNREFSLLLTQSRC 205
            |..||.....:.::|.||.|..||.||...|...:.::       ..|.|.|.:.....|..||
pombe   136 QGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNVDLGNDRTVKRC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 76/174 (44%)
RAB 20..186 CDD:197555 76/165 (46%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 76/166 (46%)
Ras 11..172 CDD:278499 76/165 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.