DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and prss1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:266 Identity:84/266 - (31%)
Similarity:123/266 - (46%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SYILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPR 73
            ::||........||.|.:: ..:|:.|.....:...:.||:         .|| |.|||:||:..
Zfish     3 AFILLALFAVAYAAPLGDD-DDKIVGGYECTKNGVPYQVSL---------NSGYHFCGGSLISNL 57

  Fly    74 KVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMH-TFSPDSMRDDVGI 137
            .|::||||.          .|...|.||..| .:...||.....|.....| :::.:::.:||.:
Zfish    58 WVVSAAHCY----------KSRVQVRLGEHN-IDVTEGTEQFINSEKVIRHPSYNSNTLDNDVML 111

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNI---LLTANVSTIRH 199
                  :.:|....::..|..:.|.......|..|.::|||....|. ||.   |:..|...:..
Zfish   112 ------IKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGNMSASG-SNYPSRLMCLNAPILSD 169

  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVE 264
            .|||..|...:...|.|||.::||.||||||||||:|...:|.|:||||||||:...||||..|.
Zfish   170 STCRNAYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVC 234

  Fly   265 YYRQWI 270
            .:..||
Zfish   235 NFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 77/242 (32%)
Tryp_SPc 33..271 CDD:238113 79/243 (33%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 77/242 (32%)
Tryp_SPc 25..243 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.