DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG17234

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:274 Identity:86/274 - (31%)
Similarity:124/274 - (45%) Gaps:55/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQENQ----QSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            |||..|...|...|    :.|||.|.....::....||::.      ||. |:|||::.:...::
  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQY------FGD-HVCGGSIYSENIIV 63

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLR 141
            |||||.::.:..|..... :.|..|  :.....|||:| .|:::.....::.|...:|:.|:.|.
  Fly    64 TAAHCFFDEEGNRLDDQG-YQVRAG--SALTDSNGTLV-DVAALIIHEEYAFDLNINDIAIVRLS 124

  Fly   142 TGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLTANVSTIRHQT----- 201
            |.|..:.      .|.||.||.....|..:..|:|||      :|.||   |.||..:.|     
  Fly   125 TPLEFTS------KVQPIPLAKTNPYPRSIALVSGWG------VSYIL---NDSTNLYPTHLQGL 174

  Fly   202 ---------CRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWG-YGCAEPGL 256
                     ||:..     |.::|||..  |..:|.||||||||...:|||||||| .||.....
  Fly   175 ALHIKSIFSCRLFD-----PSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF 232

  Fly   257 PGVYVDVEYYRQWI 270
               :|.|.|:|:||
  Fly   233 ---FVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 78/252 (31%)
Tryp_SPc 33..271 CDD:238113 79/253 (31%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 78/252 (31%)
Tryp_SPc 27..243 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.