DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG17239

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:267 Identity:86/267 - (32%)
Similarity:131/267 - (49%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WFLLACAAADLQENQ-QSRIINGSVAKADETRHLVSI----RLLRHDNNFGSGHICGGALIAPRK 74
            |..||.:...:..|. ..||:.|.:..      ::|:    .:||    .|..| ||.|:.:...
  Fly     5 WIFLAFSVTVVSSNWIPERIVGGDLIT------ILSVPWQASILR----LGRFH-CGAAIYSEDI 58

  Fly    75 VLTAAHCLYNNQRKRFRRASEFVVV-LGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGIL 138
            |:||||||.:       |.:||:.| :|  :.|....|.:| :|||: .:|.....|..:|:.::
  Fly    59 VITAAHCLTD-------RETEFLSVRVG--SSFTFFGGQVV-RVSSV-LLHEEYDQSWSNDIAVM 112

  Fly   139 FLRTGLPMSPGGGVHLTVAPIQLAGQITPP--GKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQ 200
            .|::.|.:    |..::|.|:    ..|||  |....|:|||... :.:....:|:|:|..:...
  Fly   113 RLQSKLRL----GSAVSVIPL----ADTPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQD 169

  Fly   201 TCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEY 265
            .||..|...:...|:||.  ..|.|:|.||||||||...:|||:||:|..||.|..||||.:|..
  Fly   170 QCRRSYGRKITKDMICAA--APGKDACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAE 232

  Fly   266 YRQWIEG 272
            .:.||.|
  Fly   233 LKPWILG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 79/245 (32%)
Tryp_SPc 33..271 CDD:238113 79/245 (32%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 79/245 (32%)
Tryp_SPc 24..237 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.