DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and CG34458

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:252 Identity:83/252 - (32%)
Similarity:120/252 - (47%) Gaps:24/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQR 87
            :|:...::||||.|..|...:..|.||::|       ...|.|||:||:...::|||||...   
  Fly    22 SDMDVAEESRIIGGQFAAPGQFPHQVSLQL-------NGRHHCGGSLISDTMIVTAAHCTMG--- 76

  Fly    88 KRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGV 152
               :...:...::|| |.....||...: ::.......::|.|...|:.::.|.:.:||  ||.|
  Fly    77 ---QNPGQMKAIVGT-NDLSAGNGQTFN-IAQFIIHPRYNPQSQDFDMSLIKLSSPVPM--GGAV 134

  Fly   153 HLTVAPIQLAGQIT--PPGKLCQVAGWGRTEQS-SLSNILLTANVSTIRHQTCRMIYRSGLLPGM 214
            .    .||||...:  ....:..::|:|...|: .|.|.|..|.|.......|......||...|
  Fly   135 Q----TIQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRM 195

  Fly   215 MCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            :|||...|...||||||||||..:|:|.||||||:||...|.|.:|..|...|.||:
  Fly   196 VCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 79/240 (33%)
Tryp_SPc 33..271 CDD:238113 79/240 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 79/240 (33%)
Tryp_SPc 32..254 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.