DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PRTN3

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:274 Identity:78/274 - (28%)
Similarity:118/274 - (43%) Gaps:58/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            :|...||:.||      :.:.|:.|..|:.....::.|:::   ..|.|| |.|||.||.|..||
Human    13 VLLALLLSGAA------RAAEIVGGHEAQPHSRPYMASLQM---RGNPGS-HFCGGTLIHPSFVL 67

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMA--YMHTFSPDSMRDDVGILF 139
            ||||||.:..::...      ||||..|   .|......|..|:|  :::.:..::..:||.:  
Human    68 TAAHCLRDIPQRLVN------VVLGAHN---VRTQEPTQQHFSVAQVFLNNYDAENKLNDVLL-- 121

  Fly   140 LRTGLPMSPGGGVHLTVAPIQL--AGQITPPGKLCQVAGWGRT-EQSSLSNILLTANVSTIR--- 198
                :.:|....:..:||.:||  ..|..|.|..|...||||. .....:.:|...||:.:.   
Human   122 ----IQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFC 182

  Fly   199 --HQTCRMIYR--SGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGV---VSWGYGCAEPGL 256
              |..|..:.|  :|:                |.|||||||:.:|.:.|:   |.|  |||....
Human   183 RPHNICTFVPRRKAGI----------------CFGDSGGPLICDGIIQGIDSFVIW--GCATRLF 229

  Fly   257 PGVYVDVEYYRQWI 270
            |..:..|..|..||
Human   230 PDFFTRVALYVDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/252 (28%)
Tryp_SPc 33..271 CDD:238113 73/253 (29%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.