DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:177 Identity:59/177 - (33%)
Similarity:89/177 - (50%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQS------SLSNILLT 191
            ::..|:.::...|:.....|.|...|.|..|.:.  |::|:|:|||.|..|      :|..:.|.
Zfish    39 NNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLA--GRMCRVSGWGSTSHSGGLIPLTLRTVRLP 101

  Fly   192 ANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDS---------------CQGDSGGPLVHEGRL 241
            . |||.:..:... :...:...|:|||...||.|:               ||||||||||.:||:
Zfish   102 I-VSTFKCNSSSS-FSGNITANMICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRV 164

  Fly   242 VGVVSWGYGCAEPGLPGVYVDVEYYRQWIEGRSGAPHSRL--ATGLF 286
            .|:||||.||.:|..||||..|..:|:||:....:.::|.  :.|||
Zfish   165 YGLVSWGNGCGDPRFPGVYTAVSRFRRWIDQTIYSTYARCLKSAGLF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 53/157 (34%)
Tryp_SPc 33..271 CDD:238113 54/158 (34%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 55/160 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.