DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PRSS3

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:249 Identity:77/249 - (30%)
Similarity:120/249 - (48%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRR 92
            :...:|:.|...:.:...:.||:       |.|| |.|||:||:.:.|::||||.  ..|.:.|.
Human   105 DDDDKIVGGYTCEENSLPYQVSL-------NSGS-HFCGGSLISEQWVVSAAHCY--KTRIQVRL 159

  Fly    93 ASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMH-TFSPDSMRDDVGILFLRTGLPMSPGGGVHLTV 156
            ....:.||....:|.:         ::....| .::.|::.:|:.:      :.:|....::..|
Human   160 GEHNIKVLEGNEQFIN---------AAKIIRHPKYNRDTLDNDIML------IKLSSPAVINARV 209

  Fly   157 APIQLAGQITPP--GKLCQVAGWGRTEQ--SSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCA 217
            :.|.|  ..|||  |..|.::|||.|..  :...:.|...:...:....|:..|...:...|.|.
Human   210 STISL--PTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCV 272

  Fly   218 GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            |.|:||.||||.|||||:|..|:|.||||||:|||....||||..|..|..||:
Human   273 GFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/242 (31%)
Tryp_SPc 33..271 CDD:238113 76/242 (31%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 75/242 (31%)
Tryp_SPc 110..328 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.