DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and PRSS2

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:273 Identity:84/273 - (30%)
Similarity:125/273 - (45%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPRKV 75
            ::..|:.|..||...::  .:|:.|.:.:.:...:.||:         .|| |.|||:||:.:.|
Human     5 LILTFVAAAVAAPFDDD--DKIVGGYICEENSVPYQVSL---------NSGYHFCGGSLISEQWV 58

  Fly    76 LTAAHCLYNN--QRKRFRRASEF---VVVLGTLNRFEHRNGTIVSQ---VSSMAYMHTFSPDSMR 132
            ::|.|| |.:  ..|...|..|:   .|.||     ||....:...   :::...:.....:|..
Human    59 VSAGHC-YKSAINSKLSGRGCEYHRIQVRLG-----EHNIEVLEGNEQFINAAKIIRHPKYNSRT 117

  Fly   133 DDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPP--GKLCQVAGWGRTEQSSLS--NILLTAN 193
            .|..||.::...|    ..::..|:.|.|  ...||  |....::|||.|..|...  :.|...:
Human   118 LDNDILLIKLSSP----AVINSRVSAISL--PTAPPAAGTESLISGWGNTLSSGADYPDELQCLD 176

  Fly   194 VSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPG 258
            ...:....|...|...:...|.|.|.|:||.||||||||||:|..|.|.|:||||||||:...||
Human   177 APVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPG 241

  Fly   259 VYVDVEYYRQWIE 271
            ||..|..|..||:
Human   242 VYTKVYNYVDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 78/250 (31%)
Tryp_SPc 33..271 CDD:238113 79/250 (32%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 78/250 (31%)
Tryp_SPc 24..256 CDD:238113 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.