DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:267 Identity:88/267 - (32%)
Similarity:123/267 - (46%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVL 76
            :|...||...|...|:..|:||:.|.|......:::|||:      :....|.|||.||....||
Zfish     6 LLLCVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQ------SATGQHFCGGTLINKYWVL 64

  Fly    77 TAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSP----DSMRDDVGI 137
            |||||.......|.......|.:...:.:|..              .|...|    |...::..|
Zfish    65 TAAHCNIGEANMRIVAGDYSVGLYEGMEQFRR--------------PHMLIPHPQYDRSTNNADI 115

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWG-RTEQSSLSNILLTANVSTIRHQT 201
            :.::...|:.....|.|...|.|.|  :...|:||.|:||| .|....:|:||.|..:..:....
Zfish   116 MLIKLQSPVYLNSYVSLVPLPRQDA--MVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAV 178

  Fly   202 CRMI--YRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVE 264
            |...  :...:...|:|||...||.|:|:||||||||.|||:.|:||||.|||:...||||..|.
Zfish   179 CNGTDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVS 243

  Fly   265 YYRQWIE 271
            .:||||:
Zfish   244 QFRQWID 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 80/244 (33%)
Tryp_SPc 33..271 CDD:238113 80/244 (33%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 80/244 (33%)
Tryp_SPc 27..252 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.