DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and Prss53

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:260 Identity:67/260 - (25%)
Similarity:106/260 - (40%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFS 127
            |||.|:|:|...|||||||.   ::......|.:.||||:|.:.....|.....|:::.....::
  Rat    60 HICSGSLVADTWVLTAAHCF---EKMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYN 121

  Fly   128 PDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWG------------RT 180
            ..|...|:.:|.|...:       ||.|:...|..... |.|..|...||.            ::
  Rat   122 HYSQGSDLALLQLTHPI-------VHTTLCLPQPTHHF-PFGASCWATGWDQNTSDGKYCPRHKS 178

  Fly   181 EQSSLSNIL------------LTANVS------TIRH--------QTCRMIY---RSGLL----- 211
            .:|...::|            |.:.:|      |:|:        .||..:|   ...||     
  Rat   179 RESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPAR 243

  Fly   212 PGMMCAGRLQGGTDSCQGDSGGPLV---HEGR--LVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
            .||:|.|...|....||||||||::   .:|.  .||::|:...||:...|.:..|:..:..|::
  Rat   244 SGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWLQ 308

  Fly   272  271
              Rat   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 66/257 (26%)
Tryp_SPc 33..271 CDD:238113 67/258 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 67/260 (26%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.