Sequence 1: | NP_569920.2 | Gene: | CG14780 / 31102 | FlyBaseID: | FBgn0025383 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230384.1 | Gene: | Prss53 / 499270 | RGDID: | 1566127 | Length: | 591 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 67/260 - (25%) |
---|---|---|---|
Similarity: | 106/260 - (40%) | Gaps: | 62/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFS 127
Fly 128 PDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWG------------RT 180
Fly 181 EQSSLSNIL------------LTANVS------TIRH--------QTCRMIY---RSGLL----- 211
Fly 212 PGMMCAGRLQGGTDSCQGDSGGPLV---HEGR--LVGVVSWGYGCAEPGLPGVYVDVEYYRQWIE 271
Fly 272 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14780 | NP_569920.2 | Tryp_SPc | 32..270 | CDD:214473 | 66/257 (26%) |
Tryp_SPc | 33..271 | CDD:238113 | 67/258 (26%) | ||
Prss53 | XP_006230384.1 | Tryp_SPc | 45..310 | CDD:238113 | 67/260 (26%) |
Tryp_SPc | 341..561 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |