DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and prss1.2

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:264 Identity:84/264 - (31%)
Similarity:115/264 - (43%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAA 79
            |.||..|.|........:|:.|    .:.|.|....::....|   |...|||:|:.||.:::||
 Frog     5 WILLFLAVAAAAPLDDDKIVGG----YECTPHSQPWQVYFTQN---SQVFCGGSLVTPRWIISAA 62

  Fly    80 HCLYNNQRKRFRRASEFVVVLGTLNRFEH----RNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140
            ||        :|.....|..||     :|    ..||........||.|:...|...|. .|:.:
 Frog    63 HC--------YRPPKTLVAHLG-----DHDLTKEEGTEQHIQVEAAYKHSSYKDEAYDH-DIMLV 113

  Fly   141 RTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNI---LLTANVSTIRHQTC 202
            :...|..    .:..|.||.:|......|..|.|:|:|......:...   |...:|..:...:|
 Frog   114 KLAKPAQ----YNQYVQPIPVARSCPREGTECLVSGYGNLRSDHIGEFPDRLQCVDVPVLSDSSC 174

  Fly   203 RMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYR 267
            :...|......|.|||.|:||.||||.|||||||..|.|.||||||:|||:...||||..|..|.
 Frog   175 KASCRGLFTENMFCAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGWGCAQRNAPGVYAKVCNYL 239

  Fly   268 QWIE 271
            :|::
 Frog   240 RWVQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 78/244 (32%)
Tryp_SPc 33..271 CDD:238113 79/244 (32%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.