DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and deltaTry

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:272 Identity:85/272 - (31%)
Similarity:121/272 - (44%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLACAAA-----DLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALI 70
            :::....:|||..     .|......||:.||..........:|::      ..|| |.|||::.
  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGS-HSCGGSIY 61

  Fly    71 APRKVLTAAHCLYNNQRK--RFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRD 133
            :...::||||||.:....  :.|..|.:           ..:|.:...|||......::.::|.:
  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSY-----------WSSGGVTFSVSSFKNHEGYNANTMVN 115

  Fly   134 DVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE--QSSLSNILLTANVST 196
            |:.|:.:...|..|.      |:..|.||......|....|:|||...  .||:.:.|...||:.
  Fly   116 DIAIIKINGALTFSS------TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNI 174

  Fly   197 IRHQTCRMI---YRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPG 258
            :....|...   |.|.:...|:||.  ..|.|:||||||||||..|.||||||||||||....||
  Fly   175 VSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPG 237

  Fly   259 VYVDVEYYRQWI 270
            ||.||...|.|:
  Fly   238 VYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 80/244 (33%)
Tryp_SPc 33..271 CDD:238113 80/245 (33%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.