DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and betaTry

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:90/273 - (32%)
Similarity:128/273 - (46%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLACAAA-----DLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALI 70
            :::....:|||..     .|......||:.|:..........:|::      ..|| |.|||::.
  Fly     4 FLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQ------RSGS-HSCGGSIY 61

  Fly    71 APRKVLTAAHCLYNNQRK--RFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRD 133
            :.|.::||||||.:....  :.|..|.:           ..:|.:|::|||......::.::|.:
  Fly    62 SARVIVTAAHCLQSVSASSLQIRAGSSY-----------WSSGGVVAKVSSFKNHEGYNANTMVN 115

  Fly   134 DVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNI---LLTANVS 195
            |:.:|.|.:.|..|.      |:..|.||......|....|:||| ||.|..|:|   |...||:
  Fly   116 DIAVLHLSSSLSFSS------TIKAIGLASSNPANGAAASVSGWG-TESSGSSSIPSQLRYVNVN 173

  Fly   196 TIRHQTCRMI---YRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLP 257
            .:....|...   |.:.:...|:||  ...|.||||||||||||..|.||||||||||||....|
  Fly   174 IVSQSRCSSSSYGYGNQIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYP 236

  Fly   258 GVYVDVEYYRQWI 270
            |||.||...|.|:
  Fly   237 GVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 85/245 (35%)
Tryp_SPc 33..271 CDD:238113 85/246 (35%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 85/245 (35%)
Tryp_SPc 31..252 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.