DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and zgc:92590

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:266 Identity:80/266 - (30%)
Similarity:117/266 - (43%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YILFWFLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75
            :.|....:||:|.|       :||.|.....:.....:   .|.:||   ....||.:||..|..
Zfish     6 FALLVLAVACSADD-------KIIGGYECSPNSQPWQI---YLTYDN---GQRWCGASLINDRWA 57

  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEH----RNGTIVSQVSSMAYMHTFSPDSMRDDVG 136
            ::||||        :..|:...|.||     ||    ..||.....:.....|....|...|:..
Zfish    58 VSAAHC--------YLVANRLTVHLG-----EHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDF 109

  Fly   137 ILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSL--SNILLTANVSTIRH 199
            :|     :.:......:..|.|:.|....:..|:.|.|:|||....:.:  .::|...|:..:..
Zfish   110 ML-----IKLKEPAVFNQYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTR 169

  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVE 264
            ..|...|...:...|.|||.::||.|:||||||||::..|.|.||||||||||:.|.||||.:|.
Zfish   170 AQCEGAYGWQITKNMFCAGFMEGGKDACQGDSGGPVICNGELRGVVSWGYGCADSGYPGVYTEVC 234

  Fly   265 YYRQWI 270
            .|..|:
Zfish   235 RYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 74/243 (30%)
Tryp_SPc 33..271 CDD:238113 75/244 (31%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 74/243 (30%)
Tryp_SPc 21..243 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.