DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and MST1

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:213 Identity:59/213 - (27%)
Similarity:96/213 - (45%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEH-RNGTIVSQVSSMAYMHTF 126
            |.|||:|:..:.:|||..|..:....    .:.:.|.||||  |:: ::|....|...:|.| ..
Human   531 HFCGGSLVKEQWILTARQCFSSCHMP----LTGYEVWLGTL--FQNPQHGEPSLQRVPVAKM-VC 588

  Fly   127 SPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNILLT 191
            .|...:    ::.|:....::....|.|...|.:  ..:.|||..|::||||.|:.:....:|..
Human   589 GPSGSQ----LVLLKLERSVTLNQRVALICLPPE--WYVVPPGTKCEIAGWGETKGTGNDTVLNV 647

  Fly   192 ANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPL---VHE-GRLVGVVSWGYGCA 252
            |.::.|.:|.|.:.:|..:....||...|.....:|:||.||||   .|. ..|.|::.....||
Human   648 ALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCA 712

  Fly   253 EPGLPGVYVDVEYYRQWI 270
            ....|.|:..|..:..||
Human   713 RSRWPAVFTRVSVFVDWI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 57/211 (27%)
Tryp_SPc 33..271 CDD:238113 59/213 (28%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.