DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and prss3

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001004941.1 Gene:prss3 / 448342 XenbaseID:XB-GENE-6372192 Length:249 Species:Xenopus tropicalis


Alignment Length:266 Identity:85/266 - (31%)
Similarity:122/266 - (45%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILFW---FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPR 73
            |.||   ||...||..|.:   |||:.|...........|.:       |:.....|||:|||||
 Frog     2 IPFWAMMFLAVAAAGPLDD---SRIVGGYECAPHSKPWQVHL-------NYKGSFFCGGSLIAPR 56

  Fly    74 KVLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTI-VSQVSSMAYMHTFSPDSMRDDVGI 137
            .:::||||..         ..::||....::......||: :.||......:.::..::.:|:.:
 Frog    57 WIVSAAHCYL---------LPKYVVAHIGMHDVSKAEGTVQIIQVEKSFQHYKYNSSNIDNDIML 112

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTEQSSLSNI---LLTANVSTIRH 199
            :.|     ..|....| .|.||.||......|..|.|:|:|..........   |...::..:..
 Frog   113 IKL-----AEPAQFNH-HVQPIPLAHSCPMKGTRCVVSGYGNMRPGFFGEFPDRLQCLDLPVLPE 171

  Fly   200 QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVE 264
            .:|:..|...:...|.|||..:||.||||||||||||.:|.|.||||||:.||:.|.||||..|.
 Frog   172 DSCKSSYGDDITNNMFCAGFQEGGKDSCQGDSGGPLVCDGELFGVVSWGHECAKKGYPGVYTKVC 236

  Fly   265 YYRQWI 270
            :|..|:
 Frog   237 HYIDWV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/241 (31%)
Tryp_SPc 33..271 CDD:238113 75/242 (31%)
prss3NP_001004941.1 Tryp_SPc 23..245 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.