DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14780 and KLK12

DIOPT Version :9

Sequence 1:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:257 Identity:86/257 - (33%)
Similarity:117/257 - (45%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNF-GSGHICGGALIAPRKVLTAA 79
            |||.|... |.:....:|.||:....:.....|.:        | |:...|||.||..|.|||||
Human     6 FLLLCVLG-LSQAATPKIFNGTECGRNSQPWQVGL--------FEGTSLRCGGVLIDHRWVLTAA 61

  Fly    80 HCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTI--VSQVSSMAYMHTF-----SPDSMRDDVGI 137
            ||          ..|.:.|.||     ||....:  ..|:....:..|.     :..|...|:.:
Human    62 HC----------SGSRYWVRLG-----EHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRL 111

  Fly   138 LFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE--QSSLSNILLTANVSTIRHQ 200
            |.||  ||:.    |..:|.|:.|.......|..|.|:|||.|.  ::...::|...|:|.:.|.
Human   112 LRLR--LPVR----VTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHA 170

  Fly   201 TCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY--GCAEPGLPGVY 260
            ||..:|...:...|:|||.:. |.|:||||||||||..|.|.|:||||.  .|.:.|:||||
Human   171 TCHGVYPGRITSNMVCAGGVP-GQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 81/241 (34%)
Tryp_SPc 33..271 CDD:238113 81/240 (34%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 81/241 (34%)
Tryp_SPc 22..236 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.